PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G111200.1
Common NamePOPTR_0014s10680g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 465aa    MW: 51732.4 Da    PI: 8.1174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G111200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Potri.014G111200.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding44.34.2e-1467110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg ++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Potri.014G111200.1  67 RGTFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                         899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466894.4E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.5E-151461IPR001005SANT/Myb domain
CDDcd001675.45E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.4E-2565116IPR009057Homeodomain-like
SMARTSM007177.8E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.40366116IPR017930Myb domain
PfamPF002494.4E-1367111IPR001005SANT/Myb domain
CDDcd001675.35E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENGEDKNP PASGTQDKAS AVSNTELNLL KADNSKSSGA NLQEKRSSPI  180
SPNGYQLERE STSGSKVMNG NGNNTNDHVN NNLMTPTSNK DFFLDRFTAS HHQGSTSNCQ  240
PSDFVGHFPL QQLNYASNAR LATNSIPSLW LSQTSKAFDM NSEFSSTAIP SILPPAVTSS  300
FHSTSMSYKP SITVSPDNPS LPSFTTNSCR LWETGTPRSN SNSNTVSNGS TELQSNSSFF  360
ENAIFSWGLG ECGSAEKEAQ NHLMGSQHED IKWPEYLQNP LLMAAALQNQ NQQSLYNEIK  420
SETQVVTENS SGMWPHNHQQ QQPLQNPDIC PRDIQRITAS YGYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707840.0AB970784.1 Populus nigra PniMYB055 mRNA for MYB transcriptional factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320929.10.0hypothetical protein POPTR_0014s10680g
TrEMBLB9I9970.0B9I997_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.34e-94myb domain protein 55